Invitrogen™ Human MYT1L (aa 415-488) Control Fragment Recombinant Protein

Product Code. 30206393

Brand: Invitrogen™ RP101577

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84447 (PA5-84447. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MYT1L, myelin transcription factor 1 family, to which the myelin transcription factor 1-like protein (MYT1L) belongs, is expressed primarily in the developing central nervous system and recruits histone deacetylase (HDAC) to regulate neural transcription. Both MYT1L and the related protein MYT1 interact with SIN3B, a protein that mediates transcriptional repression by binding to HDACs, suggesting that the MYT1 family favor the silencing of genes during neural development. Recent studies suggest that polymorphisms of MYT1L may be associated with schizophrenia.

Specifications

• Accession Number: Q9UL68
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23040
• Name: Human MYT1L (aa 415-488) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2900046C06Rik; 2900093J19Rik; C630034G21Rik; Kiaa1106; mKIAA1106; MRD39; myelin transcription factor 1 like; myelin transcription factor 1-like; myelin transcription factor 1-like protein; Myt1l; MyT1-L; Neural zinc finger factor 1; neural zinc finger protein NZF-1; neural zinc finger transcription factor 1; Nzf1; NZF-1; Nztf1; Pmng1; Png1; Png-1; postmeiotic neural gene 1; postmitotic neural gene 1 protein; ZC2H2C2; ZC2HC4B; zinc finger protein Png-1
• Common Name: MYT1L
• Gene Symbol: MYT1L
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VNSDRSEEVFDMTKGNLTLLEKAIALETERAKAMREKMAMEAGRRDNMRSYEDQSPRQLPGEDRKPKSSDSHVK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining