Invitrogen™ Human MYOZ3 (aa 166-251) Control Fragment Recombinant Protein

Product Code. 30203974

Brand: Invitrogen™ RP96922

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58681 (PA5-58681. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is specifically expressed in the skeletal muscle, and belongs to the myozenin family. Members of this family function as calcineurin-interacting proteins that help tether calcineurin to the sarcomere of cardiac and skeletal muscle. They play an important role in modulation of calcineurin signaling.

Specifications

• Accession Number: Q8TDC0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 91977
• Name: Human MYOZ3 (aa 166-251) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4833419K08Rik; calsarcin 3; calsarcin-3; CS3; CS-3; Fatz-3; FATZ-related protein 3; FRP3; Myoz3; myozenin 3; myozenin-3
• Common Name: MYOZ3
• Gene Symbol: MYOZ3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CPWQEFVSYRDYQSDGRSHTPSPNDYRNFNKTPVPFGGPLVGGTFPRPGTPFIPEPLSGLELLRLRPSFNRVAQGWVRNLPESEEL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining