Invitrogen™ Human MYOZ2 (aa 44-115) Control Fragment Recombinant Protein

Product Code. 30211706

Brand: Invitrogen™ RP96741

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57390 (PA5-57390. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The calcineurin-binding protein Myozenin 2, also designated calsarcin-1, is a member of the calsarcin protein family. Calcineurin is a calcium- and calmodulin-dependent protein phosphatase that is involved in controlling the slow fiber gene expression in skeletal muscle and hypertrophy of cardiac muscle. The calsarcins are sarcomeric proteins that couple calcineurin and muscle activity. In cardiac and skeletal muscle cells, Myozenin 2 binds calcineurin to α-actinin at the Z-line of the sarcomere. During embryogenesis, Myozenin 1 and 2 are expressed in developing muscle. The Myozenin 2 gene maps to chromosome 4q and is expressed specifically in adult cardiac and slow-twitch skeletal muscle, while Myozenin 1 is only detected in fast skeletal muscle.

Specifications

• Accession Number: Q9NPC6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51778
• Name: Human MYOZ2 (aa 44-115) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110012I24Rik; C4orf5; calcineurin-binding protein calsarcin-1; calsarcin-1; CMH16; CS-1; Fatz-2; FATZ-related protein 2; muscle-specific protein; myoz2; myozenin 2; myozenin-2; myozenin-like 2; Myozl2
• Common Name: MYOZ2
• Gene Symbol: MYOZ2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LEELSHLSNRGARLFKMRQRRSDKYTFENFQYQSRAQINHSIAMQNGKVDGSNLEGGSQQAPLTPPNTPDPR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining