Invitrogen™ Human MYOM3 (aa 430-512) Control Fragment Recombinant Protein

Product Code. 30195685

Brand: Invitrogen™ RP94255

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56246 (PA5-56246. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MYOM3 (myomesin 3) is a structural component of the M-band in striated muscle and is involved in sarcomere stability and resistance during intense or sustained stretching. MYOM3 can be detected mainly in intermediate speed fibers of skeletal muscle. Recently high level of MYOM3 fragments were detected in sera from patients with muscular dystrophy, including Duchenne muscular dystrophy (DMD). MYOM3 fragments may be used as serum biomarker for DMD and other neuromuscular disorders.

Specifications

• Accession Number: Q5VTT5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 127294
• Name: Human MYOM3 (aa 430-512) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 8430427K15Rik; Gm434; MYOM3; myomesin 3; Myomesin family member 3; myomesin family, member 3; myomesin-3
• Common Name: MYOM3
• Gene Symbol: Myom3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining