Invitrogen™ Human MYOCD (aa 34-97) Control Fragment Recombinant Protein

Product Code. 30196716

Brand: Invitrogen™ RP109261

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139907 (PA5-139907. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Smooth muscle cells (SM) and cardiac muscle cells-specific transcriptional factor which uses the canonical single or multiple CArG boxes DNA sequence. Acts as a cofactor of serum response factor (SRF) with the potential to modulate SRF-target genes. Plays a crucial role in cardiogenesis and differentiation of the smooth muscle cell lineage (myogenesis).

Specifications

• Accession Number: Q8IZQ8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 93649
• Name: Human MYOCD (aa 34-97) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Basic SAP coiled-coil transcription activator 2; Bsac2; BSAC2A; Mycd; Myocardin; Myocd; SRF cofactor protein; SRF co-factor protein (cardiac and smooth muscle); Srfcp; transcription factor myocardin
• Common Name: MYOCD
• Gene Symbol: Myocd
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ANQGIIPPLKRPAEFHEQRKHLDSDKAKNSLKRKARNRCNSADLVNMHILQASTAERSIPTAQM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining