Invitrogen™ Human MYOC (aa 144-228) Control Fragment Recombinant Protein

Product Code. 30199691

Brand: Invitrogen™ RP93985

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55590 (PA5-55590. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Myocilin is an extracellular protein expressed in the eye, including the retina, trabecular meshwork and ciliary body. Myocilin can form homomultimers in vivo and can also associate with components of the ECM via interactions with the Hep II domain of FibroPVRL1. In addition, myocilin interacts with myosin regulatory light chain, a component of the myosin motor protein complex. This interaction implies a role for myocilin in the actomyosin system, linking myocilin to the functional status of the trabecular meshwork (TM), which is responsible for controlling the intraocular pressure (IOP). Alterations in functions of the TM may lead to IOP elevation and development of glaucoma, a major cause of blindness. Myocilin is encoded by MYOC (also designated TIGR), a gene that maps to the GLC1A locus on chromosome 1q24. 3 and is susceptible to mutations. Mutations in the MYOC gene are specifically linked with primary open angle glaucoma (POAG), a blinding disease characterized by progressive loss of retinal ganglion cells.

Specifications

• Accession Number: Q99972
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4653
• Name: Human MYOC (aa 144-228) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI957332; GLC1A; GPOA; JOAG; JOAG1; juvenile-onset open-angle glaucoma 1; mutated trabecular meshwork-induced glucocorticoid response protein; MYOC; Myocilin; Myocilin 20 kDa N-terminal fragment; Myocilin 35 kDa N-terminal fragment; Myocilin 55 kDa subunit; myocilin trabecular meshwork inducible glucocorticoid response; myocilin trabecular meshwork inducible glucocorticoid response protein; Myocilin, C-terminal fragment; Myocilin, N-terminal fragment; myocilin, trabecular meshwork inducible glucocorticoid response; TIGR; trabecular meshwork inducible glucocorticoid response protein; trabecular meshwork-induced glucocorticoid response protein
• Common Name: MYOC
• Gene Symbol: MYOC
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NLLRDKSVLEEEKKRLRQENENLARRLESSSQEVARLRRGQCPQTRDTARAVPPGSREVSTWNLDTLAFQELKSELTEVPASRIL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining