Invitrogen™ Human MYO5A (aa 1387-1507) Control Fragment Recombinant Protein

Product Code. 30197041

Brand: Invitrogen™ RP95381

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81932 (PA5-81932. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is one of three myosin V heavy-chain genes, belonging to the myosin gene superfamily. Myosin V is a class of actin-based motor proteins involved in cytoplasmic vesicle transport and anchorage, spindle-pole alignment and mRNA translocation. The protein encoded by this gene is abundant in melanocytes and nerve cells. Mutations in this gene cause Griscelli syndrome type-1 (GS1), Griscelli syndrome type-3 (GS3) and neuroectodermal melanolysosomal disease, or Elejalde disease. Multiple alternatively spliced transcript variants encoding different isoforms have been reported, but the full-length nature of some variants has not been determined.

Specifications

• Accession Number: Q9Y4I1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4644
• Name: Human MYO5A (aa 1387-1507) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9630007J19Rik; AI413174; AI661011; D; d-120 J; Dbv; Dilute; dilute lethal-20 J protein; dilute myosin heavy chain, non-muscle; dilute-opisthotonus; Dop; flail; flailer; flr; GS1; MVa; MYH12; MYO5; Myo5a; myosin 5 A; Myosin heavy chain 12; Myosin heavy chain p190; myosin I heavy chain isoform; myosin V; myosin VA; myosin VA (heavy chain 12, myosin); myosin VA (heavy chain 12, myoxin); myosin VA (heavy polypeptide 12, myoxin); myosin, heavy polypeptide kinase; myosin-12; Myosin-V; myosin-Va; MyoVA; myoxin; MYR12; OTTMUSP00000017756; OTTMUSP00000019176; OTTMUSP00000046608; p190 myosin heavy chain; Sev-1; unconventional myosin-Va
• Common Name: MYO5A
• Gene Symbol: MYO5A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QNLQLPPEARIEASLQHEITRLTNENLDLMEQLEKQDKTVRKLKKQLKVFAKKIGELEVGQMENISPGQIIDEPIRPVNIPRKEKDFQGMLEYKKEDEQKLVKNLILELKPRGVAVNLIPG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining