missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MYO5A (aa 1387-1507) Control Fragment Recombinant Protein

Product Code. 30197041
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30197041

Brand: Invitrogen™ RP95381

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81932 (PA5-81932. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is one of three myosin V heavy-chain genes, belonging to the myosin gene superfamily. Myosin V is a class of actin-based motor proteins involved in cytoplasmic vesicle transport and anchorage, spindle-pole alignment and mRNA translocation. The protein encoded by this gene is abundant in melanocytes and nerve cells. Mutations in this gene cause Griscelli syndrome type-1 (GS1), Griscelli syndrome type-3 (GS3) and neuroectodermal melanolysosomal disease, or Elejalde disease. Multiple alternatively spliced transcript variants encoding different isoforms have been reported, but the full-length nature of some variants has not been determined.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y4I1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4644
Name Human MYO5A (aa 1387-1507) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9630007J19Rik; AI413174; AI661011; D; d-120 J; Dbv; Dilute; dilute lethal-20 J protein; dilute myosin heavy chain, non-muscle; dilute-opisthotonus; Dop; flail; flailer; flr; GS1; MVa; MYH12; MYO5; Myo5a; myosin 5 A; Myosin heavy chain 12; Myosin heavy chain p190; myosin I heavy chain isoform; myosin V; myosin VA; myosin VA (heavy chain 12, myosin); myosin VA (heavy chain 12, myoxin); myosin VA (heavy polypeptide 12, myoxin); myosin, heavy polypeptide kinase; myosin-12; Myosin-V; myosin-Va; MyoVA; myoxin; MYR12; OTTMUSP00000017756; OTTMUSP00000019176; OTTMUSP00000046608; p190 myosin heavy chain; Sev-1; unconventional myosin-Va
Common Name MYO5A
Gene Symbol MYO5A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QNLQLPPEARIEASLQHEITRLTNENLDLMEQLEKQDKTVRKLKKQLKVFAKKIGELEVGQMENISPGQIIDEPIRPVNIPRKEKDFQGMLEYKKEDEQKLVKNLILELKPRGVAVNLIPG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.