Invitrogen™ Human MYO1F (aa 909-975) Control Fragment Recombinant Protein

Artikelnummer. 30208518

Brand: Invitrogen™ RP101665

Beskrivelse

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63096 (PA5-63096. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails are presumed to bind to membranous compartments, which would be moved relative to actin filaments.

Tekniske data

• Accession Number: O00160
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4542
• Name: Human MYO1F (aa 909-975) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C330006B10Rik; MYO1F; myosin IF; myosin-1 F-like protein; myosin-ID; myosin-Ie; myosin-If; unconventional myosin-If
• Common Name: MYO1F
• Gene Symbol: MYO1F
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RTLTVSVGDGLPKSSKPTRKGMAKGKPRRSSQAPTRAAPAPPRGMDRNGVPPSARGGPLPLEIMSGG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining