Invitrogen™ Human MYL2 (aa 75-163) Control Fragment Recombinant Protein

Código de producto. 30212074

missing translation for 'mfr': Invitrogen™ RP89522

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54073 (PA5-54073. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Thus gene encodes the regulatory light chain associated with cardiac myosin beta heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy.

Especificaciones

• Accession Number: P10916
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4633
• Name: Human MYL2 (aa 75-163) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: cardiac myosin light chain 2; cardiac myosin light chain-2; cardiac ventricular myosin light chain 2; CMH10; DKFZp779C0562; hypothetical protein LOC677750; Mlc2; MLC-2; mlc2b; MLC-2 s/v; MLC2V; MLC-2 V; myl2; myl2b; Mylpc; myosin light chain 2; myosin light chain 2, slow skeletal/ventricular muscle isoform; myosin light chain 2 V; myosin light chain phosphatase; myosin light chain, phosphorylatable, cardiac ventricles; myosin light chain-2; myosin regulatory light chain 2, ventricular/cardiac muscle isoform; myosin regulatory light chain 2 b; myosin regulatory light chain ventricular isoform; myosin, light chain 2, regulatory, cardiac, slow; myosin, light chain 2 b, regulatory, cardiac, slow; myosin, light polypeptide 2, regulatory, cardiac, slow; myosin, light polypeptide 2 b, regulatory, cardiac, slow; regulatory light chain of myosin; RLC of myosin; slow cardiac myosin regulatory light chain 2; ventricular myosin light chain 2; ventricular myosin regulatory light chain; zgc:136848
• Common Name: MYL2
• Gene Symbol: MYL2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining