Invitrogen™ Human MYH14 (aa 310-361) Control Fragment Recombinant Protein

Product Code. 30194185

Brand: Invitrogen™ RP104174

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-66483 (PA5-66483, PA5-64436 (PA5-64436. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping.

Specifications

• Accession Number: Q7Z406
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79784
• Name: Human MYH14 (aa 310-361) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2400004E04Rik; DFNA4; DFNA4A; FP17425; II-C; KIAA2034; MHC16; Myh14; MYH14 variant protein; MYH17; myosin; myosin heavy chain 14; Myosin heavy chain, non-muscle IIc; myosin, heavy chain 14; myosin, heavy chain 14, non-muscle; myosin, heavy polypeptide 14; myosin-14; NHMCII; NMHC II-C; NMHC-II-C; nonmuscle myosin heavy chain; Non-muscle myosin heavy chain IIc; nonmuscle myosin heavy chain II-C; PNMHH
• Common Name: MYH14
• Gene Symbol: MYH14
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GAGEQLKADLLLEPCSHYRFLTNGPSSSPGQERELFQETLESLRVLGFSHEE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining