missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198127

Invitrogen™ Human MYH11 (aa 1176-1272) Control Fragment Recombinant Protein

Product Code. 30198127
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198127

Brand: Invitrogen™ RP89633

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82526 (PA5-82526. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SM-MHC is a cytoplasmic structural protein, which is a major component of the contractile apparatus in smooth muscle cells. Expression of smooth muscle myosin is developmently regulated, appearing early in smooth muscle development, and is specific for smooth muscle development. Two isoforms of smooth muscle myosin heavy chain have been identified, designated MHC-1 and MHC-2.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P35749
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4629
Name Human MYH11 (aa 1176-1272) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AAT4; AV071570; contractile protein; FAA4; KIAA0866; LOW QUALITY PROTEIN: myosin-11; Myh11; myh11 {ECO:0000312; Myosin heavy chain 11; myosin heavy chain 11, smooth muscle; myosin heavy chain 21; myosin heavy chain isoform SMA; myosin heavy chain SMA; myosin heavy chain, smooth muscle isoform; myosin, heavy chain 11, smooth muscle; myosin, heavy polypeptide 11, smooth muscle; myosin-11; RGD:3136}; SM1; SM2; SMHC; SMMHC; smooth muscle myosin heavy chain
Common Name MYH11
Gene Symbol MYH11
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.