Invitrogen™ Human MYCBPAP (aa 650-769) Control Fragment Recombinant Protein

Product Code. 30212829

Brand: Invitrogen™ RP93327

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (48%), Rat (48%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54736 (PA5-54736. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MYCBPAP is a protein coding gene.

Specifications

• Accession Number: Q8TBZ2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84073
• Name: Human MYCBPAP (aa 650-769) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4932408B01Rik; AMAM-1; AMAP1; AMAP-1; AMY1-associating protein 1; AMY-1-binding protein 1; AW125474; cochlea derived protein of 106 kDa; COD106; LOW QUALITY PROTEIN: MYCBP-associated protein; MYCBP associated protein; MYCBPAP; mycbpap {ECO:0000312; MYCBP-associated protein; MYCBP-associated protein; LOW QUALITY PROTEIN: MYCBP-associated protein; Organ of Corti membrane-associated protein of 106 kDa; RGD:1359123}; testis secretory sperm-binding protein Li 214 e
• Common Name: MYCBPAP
• Gene Symbol: MYCBPAP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLPRFRSPISETQVPRPENEALRESGSQKARVGTKSPQRKSIMEEILVEESPDVDSTKSPWEPDGLPLLEWNLCLEDFRKAVMVLPDENHREDALMRLNKAALELCQKPRPLQSNLLHQM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining