missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30202990

Invitrogen™ Human MYBPC3 (aa 705-774) Control Fragment Recombinant Protein

Product Code. 30202990
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202990

Brand: Invitrogen™ RP97333

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83689 (PA5-83689. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Myosin binding protein C, cardiac-type (MYBPC3) is a thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments. It modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role. Mutations affecting the gene can result in cardiomyopathy - familial hypertrophic 4, cardiomyopathy - dilated 1MM, or left ventricular non-compaction 10.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q14896
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4607
Name Human MYBPC3 (aa 705-774) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias cardiac C-protein; cardiac MyBP-C; cardiac myosin binding protein C; CMD1MM; CMH4; C-protein, cardiac muscle isoform; DKFZp779E1762; FHC; LVNC10; MYBP-C; Mybpc3; myosin binding protein C, cardiac; myosin binding protein C3; myosin-binding protein C, cardiac-type; truncated cardiac myosin-binding protein C
Common Name MYBPC3
Gene Symbol MYBPC3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.