Invitrogen™ Human MYBBP1A (aa 104-234) Control Fragment Recombinant Protein

Product Code. 30202713

Brand: Invitrogen™ RP102516

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Myb family of transcription factors, which includes the structurally related A-, B-, and c-Myb genes, regulate differentiation, cellular growth and transactivating gene expression. c-Myb plays an essential role in controlling the proliferation and differentiation of hematopoietic cells, cellular levels of c-Myb decreasing as cells reach terminal differentiation. Myb-binding protein 1A (MYBBP1A) is a novel nuclear protein localized predominantly, but not exclusively, in nucleoli. Although initially isolated as a c-Myb-interacting protein, MYBBP1A is expressed ubiquitously, and associates with a number of different transcription factors. MYBBP1A associates with the aromatic hydrocarbon receptor (AhR), enhancing transactivation and increasing AhR-dependent gene expression. MYBBP1A is a powerful negative regulator of PPAR gamma coactivator 1 alpha (PGC-1 alpha) by p38 MAPK and also acts as a nucleocytoplasmic shuttling protein that utilizes CRM1-dependent and independent nuclear export pathways.

Specifications

• Accession Number: Q9BQG0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10514
• Name: Human MYBBP1A (aa 104-234) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AL024407; AU019902; DBP; MYB binding protein 1 A; MYB binding protein (P160) 1 A; MYB binding protein 1 A; myb-binding protein 1 A; Myb-binding protein of 160 kDa; MYBBP1A; nuclear protein P160; P160; p160MBP; p53-activated protein-2; p67MBP; PAP2; PAR interacting protein; PAR-interacting protein; PIP
• Common Name: MYBBP1A
• Gene Symbol: MYBBP1A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EDLPLCSILQQIQEKYDLHQVKKAMLRPALFANLFGVLALFQSGRLVKDQEALMKSVKLLQALAQYQNHLQEQPRKALVDILSEVSKATLQEILPEVLKADLNIILSSPEQLELFLLAQQKVPSKLKKLVG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining