Invitrogen™ Human MX1 (aa 574-644) Control Fragment Recombinant Protein

Product Code. 30209957

Brand: Invitrogen™ RP104885

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (55%), Rat (55%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83975 (PA5-83975. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a guanosine triphosphate (GTP)-metabolizing protein that participates in the cellular antiviral response. The encoded protein is induced by type I and type II interferons and antagonizes the replication process of several different RNA and DNA viruses. There is a related gene located adjacent to this gene on chromosome 21, and there are multiple pseudogenes located in a cluster on chromosome 4. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: P20591
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4599
• Name: Human MX1 (aa 574-644) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI893580; GTP-binding protein; IFI78; IFI-78 K; Influenza resistance protein; Interferon-induced GTP-binding protein M x 1; Interferon-induced GTP-binding protein M x 1, N-terminally processed; Interferon-induced protein p78; interferon-inducible myxovirus resistance-1 protein; interferon-inducible protein p78; interferon-regulated resistance GTP-binding protein MxA; Mx; MX dynamin like GTPase 1; MX dynamin-like GTPase 1; M x 1; Mx-1; M x 1 B; M x 1-b; MxA; Myxoma resistance protein 1; myxovirus (influenza virus) resistance 1; myxovirus (influenza virus) resistance 1, interferon-inducible protein p78; myxovirus (influenza) resistance 1 polypeptide; myxovirus resistance protein 1
• Common Name: MX1
• Gene Symbol: Mx1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MEEIFQHLMAYHQEASKRISSHIPLIIQFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKERSDTSDKRKFLK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining