missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MX1 (aa 506-573) Control Fragment Recombinant Protein

Product Code. 30195143
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30195143

Brand: Invitrogen™ RP95880

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56590 (PA5-56590. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a guanosine triphosphate (GTP)-metabolizing protein that participates in the cellular antiviral response. The encoded protein is induced by type I and type II interferons and antagonizes the replication process of several different RNA and DNA viruses. There is a related gene located adjacent to this gene on chromosome 21, and there are multiple pseudogenes located in a cluster on chromosome 4. Alternative splicing results in multiple transcript variants.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P20591
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4599
Name Human MX1 (aa 506-573) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI893580; GTP-binding protein; IFI78; IFI-78 K; Influenza resistance protein; Interferon-induced GTP-binding protein M x 1; Interferon-induced GTP-binding protein M x 1, N-terminally processed; Interferon-induced protein p78; interferon-inducible myxovirus resistance-1 protein; interferon-inducible protein p78; interferon-regulated resistance GTP-binding protein MxA; Mx; MX dynamin like GTPase 1; MX dynamin-like GTPase 1; M x 1; Mx-1; M x 1 B; M x 1-b; MxA; Myxoma resistance protein 1; myxovirus (influenza virus) resistance 1; myxovirus (influenza virus) resistance 1, interferon-inducible protein p78; myxovirus (influenza) resistance 1 polypeptide; myxovirus resistance protein 1
Common Name MX1
Gene Symbol Mx1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRGALQKVREKELEEEKKKKSWDFGAFQSSSATDSS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.