Invitrogen™ Human Muskelin (aa 566-672) Control Fragment Recombinant Protein

Product Code. 30195721

Brand: Invitrogen™ RP92714

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54611 (PA5-54611. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Muskelin is an intracellular protein that acts as a mediator of cell spreading and cytoskeletal responses to the extracellular matrix component thrombospondin I.

Specifications

• Accession Number: Q9UL63
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4289
• Name: Human Muskelin (aa 566-672) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A130067F06Rik; AU015903; BB154892; cytoplasmic mediator; fc60a07; LOW QUALITY PROTEIN: muskelin; Mkln1; mkln1 protein; Msk; Muskelin; muskelin 1; muskelin 1, intracellular mediator containing kelch motifs; TWA2; wu:fc60a07
• Common Name: Muskelin
• Gene Symbol: MKLN1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QAAKDNPTKSLQEEEPCPRFAHQLVYDELHKVHYLFGGNPGKSCSPKMRLDDFWSLKLCRPSKDYLLRHCKYLIRKHRFEEKAQVDPLSALKYLQNDLYITVDHSDP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining