Invitrogen™ Human MURF3 (aa 271-357) Control Fragment Recombinant Protein

Product Code. 30196546

Brand: Invitrogen™ RP92301

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54058 (PA5-54058. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene contains a RING finger motif and is highly similar to the ring finger proteins RNF28/MURF1 and RNF29/MURF2. In vitro studies demonstrated that this protein, RNF28, and RNF29 form heterodimers, which may be important for the regulation of titin kinase and microtubule-dependent signal pathways in striated muscles. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Specifications

• Accession Number: Q9BYV2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57159
• Name: Human MURF3 (aa 271-357) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4930486E09Rik; 4930566I02Rik; MURF; MURF3; MuRF-3; Muscle-specific RING finger protein; Muscle-specific RING finger protein 3; muscle-specific RING-finger protein; muscle-specific RING-finger protein 3; OTTHUMP00000122598; ring finger protein 30; Rnf30; TRIM54; tripartite motif containing 54; tripartite motif-containing 54; tripartite motif-containing protein 54
• Common Name: MURF3
• Gene Symbol: TRIM54
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MEEPQMALYLQQAKELINKVGAMSKVELAGRPEPGYESMEQFTVRVEHVAEMLRTIDFQPGASGEEEEVAPDGEEGSAGPEEERPDG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining