Invitrogen™ Human MURF2 (aa 182-249) Control Fragment Recombinant Protein

Product Code. 30194643

Brand: Invitrogen™ RP93811

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62826 (PA5-62826. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transient adaptor and plays a regulatory role in the assembly of sarcomeres. Four alternatively spliced transcript variants encoding distinct isoforms have been described.

Specifications

• Accession Number: Q9BYV6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84675
• Name: Human MURF2 (aa 182-249) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: D830041C10Rik; MURF2; MuRF-2; muscle specific ring finger 2; muscle-specific RING finger protein 2; RING finger protein 29; RNF29; Trim55; tripartite motif containing 55; tripartite motif-containing 55; tripartite motif-containing protein 55
• Common Name: MURF2
• Gene Symbol: TRIM55
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SNDRVQGVISQLEDTCKTIEECCRKQKQELCEKFDYLYGILEERKNEMTQVITRTQEEKLEHVRALIK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining