Invitrogen™ Human MURC (aa 95-180) Control Fragment Recombinant Protein

Product Code. 30210357

Brand: Invitrogen™ RP93058

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54308 (PA5-54308. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MURC induces RHOA activation and activates NPPA transcription and myofibrillar organization through the Rho/ROCK signaling pathway.

Specifications

• Accession Number: Q5BKX8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 347273
• Name: Human MURC (aa 95-180) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310039E09Rik; Caveolae-associated protein 4; cavin 4; CAVIN4; cavin-4; Murc; muscle related coiled-coil protein; muscle-related coiled-coil protein; Muscle-restricted coiled-coil protein
• Common Name: MURC
• Gene Symbol: CAVIN4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KVSAHIKDVKARVEKQQIHVKKVEVKQEEIMKKNKFRVVIFQEKFRCPTSLSVVKDRNLTENQEEDDDDIFDPPVDLSSDEEYYVE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining