Invitrogen™ Human Munc13-4 (aa 467-548) Control Fragment Recombinant Protein

Product Code. 30193689

Brand: Invitrogen™ RP107938

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that is a member of the UNC13 family, containing similar domain structure as other family members but lacking an N-terminal phorbol ester-binding C1 domain present in other Munc13 proteins. The protein appears to play a role in vesicle maturation during exocytosis and is involved in regulation of cytolytic granules secretion. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis type 3, a genetically heterogeneous, rare autosomal recessive disorder.

Specifications

• Accession Number: Q70J99
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 201294
• Name: Human Munc13-4 (aa 467-548) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610108D09Rik; FHL3; HLH3; HPLH3; Jinx; likely ortholog of H. sapiens unc-13 homolog D (UNC13D); mFLJ00067; munc 13-4; Munc13-4; Protein unc-13 homolog D; unc-13 homolog D; unc-13 homolog D (C. elegans); Unc13d
• Common Name: Munc13-4
• Gene Symbol: Unc13d
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TEWFHLKQQHHQPMVQGIPEAGKALLGLVQDVIGDLHQCQRTWDKIFHNTLKIHLFSMAFRELQWLVAKRVQDHTTVVGDVV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining