Invitrogen™ Human MUM1 (aa 519-601) Control Fragment Recombinant Protein

Product Code. 30212075

Brand: Invitrogen™ RP110151

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144850 (PA5-144850. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mutated melanoma-associated antigen 1 (MUM1) is a 78 kDa protein encoded by the MUM1 gene. MUM1 is expressed in a subset of B cells in the light zone of the germinal center, plasma cells, activated T cells and a wide spectrum of related hematolymphoid neoplasms. Antibodies to MUM1 are useful in the sub classification of lymphoid malignancies.

Specifications

• Accession Number: Q2TAK8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84939
• Name: Human MUM1 (aa 519-601) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610019J09; 9430059D04Rik; EXPAND1; FLJ14868; FLJ22283; HSPC211; melanoma associated antigen (mutated) 1; melanoma ubiquitous mutated protein; MGC131891; MGC163315; Mum1; MUM-1; Mutated melanoma-associated antigen 1; protein expandere; PWWP domain-containing DNA repair factor 3 A; PWWP domain-containing protein MUM1; Pwwp3a; UBE-1C2
• Common Name: MUM1
• Gene Symbol: MUM1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PVRKSIQQDVLGTKLPQLSKGSPEEPVVGCPLGQRQPCRKMLPDRSRAARDRANQKLVEYIVKAKGAESHLRAILKSRKPSRW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining