Invitrogen™ Human MUC7 (aa 32-162) Control Fragment Recombinant Protein

Product Code. 30211037

Brand: Invitrogen™ RP88569

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (26%), Rat (26%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52292 (PA5-52292. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a small salivary mucin, which is thought to play a role in facilitating the clearance of bacteria in the oral cavity and to aid in mastication, speech, and swallowing. The central domain of this glycoprotein contains tandem repeats, each composed of 23 amino acids. This antimicrobial protein has antibacterial and antifungal activity. The most common allele contains 6 repeats, and some alleles may be associated with susceptibility to asthma. Alternatively spliced transcript variants with different 5' UTR, but encoding the same protein, have been found for this gene.

Specifications

• Accession Number: Q8TAX7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4589
• Name: Human MUC7 (aa 32-162) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: apo-MG2; MG2; MUC7; MUC-7; mucin 7, salivary; mucin 7, secreted; mucin-7; Salivary mucin-7
• Common Name: MUC7
• Gene Symbol: MUC7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RRHHHQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQNATTISSRENVNTSSSVATLAPVNSPAP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining