Invitrogen™ Human MUC4 (aa 4972-5104) Control Fragment Recombinant Protein

Product Code. 30203165

Brand: Invitrogen™ RP88564

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Nearly all mucosal surfaces are protected by mucin transmembrane glycoproteins, from bronchioles to corneas to reproductive tracts. Mucin 4 (MUC4) is membrane-bound and is important in protecting and lubricating. MUC4 expression is erroneous in many carcinomas and sarcomas, including fibromyoxoid sarcoma and pancreatic adenocarcinoma. Immunohistochemical staining for MUC4 has been discussed as a potential biomarker for detection of these cancers. MUC4 seems to be most predominantly affected in Asian diseases - Taiwanese infertility and endometriosis, as well as gallstone formation in Chinese men, are connected to MUC4, where similar diseases in other populations do not share these MUC4 mutations. Because MUC4 is so important in mucosal surface protection, it is not surprising that it has been implicated as failing in many metastatic cancer invasions.

Specifications

• Accession Number: Q99102
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4585
• Name: Human MUC4 (aa 4972-5104) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4933405I11Rik; Ascites sialoglycoprotein; Ascites sialoglycoprotein 1; Ascites sialoglycoprotein 2; ASGP; ASGP1; ASGP-1; ASGP-2; HSA276359; MUC4; MUC-4; mucin 4; mucin 4, ASGP; mucin 4, cell surface associated; mucin 4, tracheobronchial; Mucin4; mucin-4; Mucin-4 alpha chain; Mucin-4 beta chain; Pancreatic adenocarcinoma mucin; pre-sialomucin complex; Psmc; sialomucin ascites sialoglycoprotein-1; sialomucin complex; testis mucin; Tracheobronchial mucin
• Common Name: MUC4
• Gene Symbol: MUC4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IQYTSNAEDANFTLRDSCTDLELFENGTLLWTPKSLEPFTLEILARSAKIGLASALQPRTVVCHCNAESQCLYNQTSRVGNSSLEVAGCKCDGGTFGRYCEGSEDACEEPCFPSVHCVPGKGCEACPPNLTGD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining