Invitrogen™ Human MUC12 (aa 5248-5367) Control Fragment Recombinant Protein

Product Code. 30213454

Brand: Invitrogen™ RP88567

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (35%), Rat (35%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54896 (PA5-54896. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Epitheial mucins are secreted glycoproteins that play roles in cell protection, adhesion modulation and signaling. MUC12 is a novel mucin gene and may be involved in epithelial cell growth regulation. MUC12 is down-regulated in colorectal cancers.

Specifications

• Accession Number: Q9UKN1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10071
• Name: Human MUC12 (aa 5248-5367) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: MUC11; MUC-11; MUC12; MUC-12; mucin 11; mucin 12, cell surface associated; mucin-11; Mucin12; Mucin-12
• Common Name: MUC12
• Gene Symbol: MUC12
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EELFENLAEIVKAKIMNETRTTLLDPDSCRKAILCYSEEDTFVDSSVTPGFDFQEQCTQKAAEGYTQFYYVDVLDGKLACVNKCTKGTKSQMNCNLGTCQLQRSGPRCLCPNTNTHWYWG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining