Invitrogen™ Human MTSS1L (aa 374-464) Control Fragment Recombinant Protein

Product Code. 30181310

Brand: Invitrogen™ RP98559

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61763 (PA5-61763. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Involved in plasma membrane dynamics. Potentiated PDGF-mediated formation of membrane ruffles and lamellipodia in fibroblasts, acting via RAC1 activation (PubMed:14752106). May function in actin bundling (PubMed:14752106). [UniProt]

Specifications

• Accession Number: Q765P7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 92154
• Name: Human MTSS1L (aa 374-464) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ABBA; ABBA1; ABBA-1; actin-bundling protein with BAIAP2 homology; actin-bundling with BAIAP2 homology protein 1; LOC92154; metastasis suppressor 1 like; metastasis suppressor 1-like; Mtss1l; MTSS1-like protein; MTSS2; Protein MTSS 2
• Common Name: MTSS1L
• Gene Symbol: Mtss1l
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PTSDWSKVGSHEQPSGATLQRRKDRVELLRDTEPGPASGGTLGPSGEEAPRPRMSPATIAAKHGEEVSPAASDLAMVLTRGLSLEHQKSSR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining