missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MTSS1 (aa 656-722) Control Fragment Recombinant Protein

Product Code. 30196208
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196208

Brand: Invitrogen™ RP109054

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Metastasis suppressor protein 1 (MTSS1) [MIM, 'missing in metastasis'], was first discovered as missing transcripts from metastatic bladder and prostate cancer cells. MTSS1 is a 755 amino acid protein, having multidomain and scaffolding function. It has a proline-rich/SH3 binding region and a serine-rich region with EGF or PDGF/Src consensus sites. It contains anactin-binding Wiskott-Aldrich syndrome protein homology-2 motif (WH2) at the C-terminus while the N-terminal IMD domain (IRSp53-MIM domain) interact with membranes and bundle actin filament. The WH2 domain binds to actin monomers and plays an important role in actin cytoskeleton reorganization. Recently, MIM was found to interact with cortactin via SH3 domains. In addition, MTSS1 enhanced cortactin- and Arp2/3-dependent actin polymerization. It is thus involved in cell motility and morphogenesis and also interacts with sonic hedgehog/Gli signaling in epidermal cells. MTSS1 acts as an important regulator of cell growth and development and is known to express in many tissues, including spleen, thymus, prostate, testis, uterus, colon, and peripheral blood.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O43312
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9788
Name Human MTSS1 (aa 656-722) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310003N14Rik; actin monomer-binding protein; BC024131; D130001D01Rik; hypothetical protein; KIAA0429; metastasis suppressor 1; metastasis suppressor protein 1; Metastasis suppressor YGL-1; Mim; MIMA; MIMB; missing in metastasis protein; mKIAA0429; MTSS I-BAR domain containing 1; MTSS1; MTSS1, I-BAR domain containing; Protein MTSS 1; protein MTSS 1; metastasis suppressor protein 1
Common Name MTSS1
Gene Symbol MTSS1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GVTSMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQEREPPSATVSPGQIPESDPADLSP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.