Invitrogen™ Human MTSS1 (aa 328-401) Control Fragment Recombinant Protein

Product Code. 30198623

Brand: Invitrogen™ RP105598

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84986. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Metastasis suppressor protein 1 (MTSS1) [MIM, 'missing in metastasis'], was first discovered as missing transcripts from metastatic bladder and prostate cancer cells. MTSS1 is a 755 amino acid protein, having multidomain and scaffolding function. It has a proline-rich/SH3 binding region and a serine-rich region with EGF or PDGF/Src consensus sites. It contains anactin-binding Wiskott-Aldrich syndrome protein homology-2 motif (WH2) at the C-terminus while the N-terminal IMD domain (IRSp53-MIM domain) interact with membranes and bundle actin filament. The WH2 domain binds to actin monomers and plays an important role in actin cytoskeleton reorganization. Recently, MIM was found to interact with cortactin via SH3 domains. In addition, MTSS1 enhanced cortactin- and Arp2/3-dependent actin polymerization. It is thus involved in cell motility and morphogenesis and also interacts with sonic hedgehog/Gli signaling in epidermal cells. MTSS1 acts as an important regulator of cell growth and development and is known to express in many tissues, including spleen, thymus, prostate, testis, uterus, colon, and peripheral blood.

Specifications

• Accession Number: O43312
• Concentration: 3.8 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9788
• Name: Human MTSS1 (aa 328-401) Control Fragment
• pH Range: 7.4
• Purification Method: Metal-chelate chromatography
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2310003N14Rik; actin monomer-binding protein; BC024131; D130001D01Rik; hypothetical protein; KIAA0429; metastasis suppressor 1; metastasis suppressor protein 1; Metastasis suppressor YGL-1; Mim; MIMA; MIMB; missing in metastasis protein; mKIAA0429; MTSS I-BAR domain containing 1; MTSS1; MTSS1, I-BAR domain containing; Protein MTSS 1; protein MTSS 1; metastasis suppressor protein 1
• Common Name: MTSS1
• Gene Symbol: MTSS1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DAFQSKSPSPMPPEAPNQLSNGFSHYSLSSESHVGPTGAGLFPHCLPASRLLPRVTSVHLPDYAHYYTIGPGMF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining