Invitrogen™ Human MTRES1 (aa 82-165) Control Fragment Recombinant Protein

Product Code. 30211019

Brand: Invitrogen™ RP101265

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62000 (PA5-62000. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MTRES1 is a mitochondrial RNA-binding protein involved in mitochondrial transcription regulation. It functions as a protective factor to maintain proper mitochondrial RNA level during stress. It acts at the transcription level and its protective function depends on its RNA binding ability.

Specifications

• Accession Number: Q9P0P8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51250
• Name: Human MTRES1 (aa 82-165) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C6orf203; chromosome 6 open reading frame 203; HSPC230; Mitochondrial transcription rescue factor 1; MTRES1; PRED31; uncharacterized protein C6orf203
• Common Name: MTRES1
• Gene Symbol: C6orf203, MTRES1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VRLKSNIRSTKSTKKSLQKVDEEDSDEESHHDEMSEQEEELEDDPTVVKNYKDLEKAVQSFRYDVVLKTGLDIGRNKVEDAFYK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining