missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human mTOR Control Fragment Recombinant Protein

Product Code. 30209924
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209924

Brand: Invitrogen™ RP107805

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FRAP1 (mTOR) is a serine/threonine kinase that plays a critical role in cellular growth and proliferation. Perturbations in the mTOR/PI3-kinase/AKT pathway are associated with numerous forms of cancer. FRAP1 is also the target of rapamycin and its analogues, which are currently used as immunosuppressants and cancer therapeutics. Mutations affecting the gene results in Smith-Kingsmore syndrome.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P42345
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2475
Name Human mTOR Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610315D21Rik; AI327068; angiopoietin-like factor CDT6; FK506 binding protein 12-rapamycin associated protein 1; FK506 binding protein 12-rapamycin associated protein 2; FK506-binding protein 12-rapamycin complex-associated protein 1; FKBP12-rapamycin complex-associated protein; FKBP12-rapamycin complex-associated protein 1; FKBP-rapamycin associated protein; FKBP-rapamycin associated protein (FRAP); FKBP-rapamycin-associated protein FRAP; flat; FRAP; FRAP1; FRAP2; Mammalian target of rapamycin; mechanistic target of rapamycin; mechanistic target of rapamycin (serine/threonine kinase); mechanistic target of rapamycin kinase; Mtor; m-TOR; mTORC1; Raft1; Rapamycin and FKBP12 target 1; rapamycin and FKBP12 target-1 protein; rapamycin associated protein FRAP2; rapamycin target protein 1; RAPT1; serine/threonine-protein kinase mTOR; SKS
Common Name mTOR
Gene Symbol MTOR
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TESLDSTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.