Invitrogen™ Human MTHFD1L (aa 229-304) Control Fragment Recombinant Protein

Product Code. 30211638

Brand: Invitrogen™ RP105595

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84967 (PA5-84967. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

One-carbon substituted forms of tetrahydrofolate (THF) are involved in the de novo synthesis of purines and thymidylate and support cellular methylation reactions through the regeneration of methionine from homocysteine. MTHFD1L is an enzyme involved in THF synthesis in mitochondria (Christensen et al., 2005 [PubMed 15611115]).

Specifications

• Accession Number: Q6UB35
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 25902
• Name: Human MTHFD1L (aa 229-304) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 10-formyl-THF synthetase; 2410004L15Rik; AI647056; dJ292B18.2; Formyltetrahydrofolate synthetase; formyltetrahydrofolate synthetase domain containing 1; FTHFSDC1; methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like; monofunctional C1-tetrahydrofolate synthase, mitochondrial; MTC1THFS; MTHFD1L
• Common Name: MTHFD1L
• Gene Symbol: MTHFD1L
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HGSLEAALQCLFQRKGSMTMSIQWKTRQLQSKLHEADIVVLGSPKPEEIPLTWIQPGTTVLNCSHDFLSGKVGCGS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining