Invitrogen™ Human MTHFD1 Control Fragment Recombinant Protein

Product Code. 30181048

Brand: Invitrogen™ RP98840

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110628 (PA5-110628. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that possesses three distinct enzymatic activities, 5,10-methylenetetrahydrofolate dehydrogenase, 5,10-methenyltetrahydrofolate cyclohydrolase and 10-formyltetrahydrofolate synthetase. Each of these activities catalyzes one of three sequential reactions in the interconversion of 1-carbon derivatives of tetrahydrofolate, which are substrates for methionine, thymidylate, and de novo purine syntheses. The trifunctional enzymatic activities are conferred by two major domains, an aminoterminal portion containing the dehydrogenase and cyclohydrolase activities and a larger synthetase domain.

Spezifikation

• Accession Number: P11586
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4522
• Name: Human MTHFD1 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5,10-methylenetetrahydrofolate dehydrogenase, 5,10-methylenetetrahydrofolate cyclohydrolase, 10-formyltetrahydrofolate synthetase; C1-tetrahydrofolate synthase; C-1-tetrahydrofolate synthase, cytoplasmic; C-1-tetrahydrofolate synthase, cytoplasmic, N-terminally processed; C1-THF synthase; cytoplasmic C-1-tetrahydrofolate synthase; Dcs; E430024A07Rik; Formyltetrahydrofolate synthetase; LOW QUALITY PROTEIN: C-1-tetrahydrofolate synthase, cytoplasmic; methenyltetrahydrofolate; methenyltetrahydrofolate cyclohydrolase; Methylenetetrahydrofolate dehydrogenase; methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1, methenyltetrahydrofolate cyclohydrolase, formyltetrahydrofolate synthetase; methylenetetrahydrofolate dehydrogenase (NADP+ dependent), methenyltetrahydrofolate cyclohydrolase, formyltetrahydrofolate synthase; methylenetetrahydrofolate dehydrogenase 1; methylenetetrahydrofolate dehydrogenase, cyclohydrolase and formyltetrahydrofolate synthetase 1; MTHFC; MTHFD; MTHFD1; MTHFD1 protein; formyltetrahydrofolate synthetase; methenyltetrahydrofolate cyclohydrolase
• Common Name: MTHFD1
• Gene Symbol: MTHFD1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ILVVATGQPEMVKGEWIKPGAIVIDCGINYVPDDKKPNGRKVVGDVAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAKRFLEKFKPGKWMIQYNNLNLKTPVPSDIDISRSCKPKPIGKLAREIGLLSEEVELYGETKAKVLLSALEGAPHR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining