Invitrogen™ Human MTG16 (aa 4-74) Control Fragment Recombinant Protein

Product Code. 30210929

Brand: Invitrogen™ RP105373

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (42%), Rat (42%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-66294 (PA5-66294, PA5-66808 (PA5-66808. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the myeloid translocation gene family which interact with DNA-bound transcription factors and recruit a range of corepressors to facilitate transcriptional repression. The t(16;21)(q24;q22) translocation is one of the less common karyotypic abnormalities in acute myeloid leukemia. The translocation produces a chimeric gene made up of the 5'-region of the runt-related transcription factor 1 gene fused to the 3'-region of this gene. This gene is also a putative breast tumor suppressor. Alternative splicing results in transcript variants.

Specifications

• Accession Number: O75081
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 863
• Name: Human MTG16 (aa 4-74) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A630044F12Rik; AI465270; AW229127; CBFA2/RUN x 1 partner transcriptional co-repressor 3; CBFA2/RUN x 1 translocation partner 3; CBFA2T3; Cbfa2t3h; core-binding factor, runt domain, alpha subunit 2, translocated to, 3; core-binding factor, runt domain, alpha subunit 2, translocated to, 3 (human); core-binding factor, runt domain, alpha subunit 2; translocated to, 3; eight twenty one protein 2; ETO/MTG8-related protein ETO-2; Eto2; ETO-2; hMTG16; MTG16; MTG16HEL; MTG8-related gene 2; MTG8-related protein 2; MTGR2; myeloid translocation gene 8 and 16 b; myeloid translocation gene on chromosome 16 protein; myeloid translocation gene-related protein 2; protein CBFA2T3; Protein ETO-2; RUN x 1T3; translocated to, 3; zinc finger MYND domain-containing protein 4; ZMYND4
• Common Name: MTG16
• Gene Symbol: CBFA2T3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SRLRDRAASSASGSTCGSMSQTHPVLESGLLASAGCSAPRGPRKGGPAPVDRKAKASAMPDSPAEVKTQPR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining