Invitrogen™ Human MTFR1 (aa 261-332) Control Fragment Recombinant Protein

Product Code. 30203864

Brand: Invitrogen™ RP93736

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54709 (PA5-54709. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a mitochondrial protein that is characterized by a poly-proline rich region. A chicken homolog of this protein promotes mitochondrial fission and the mouse homolog protects cells from oxidative stress. A related pseudogene of this gene is found on chromosome X.

Specifications

• Accession Number: Q15390
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9650
• Name: Human MTFR1 (aa 261-332) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1300002C08Rik; 1700080D04Rik; 2810026O10Rik; 4930579E05Rik; chondrocyte protein with a poly-proline region; CHPPR; FAM54A2; Kiaa0009; Mitochondrial fission regulator 1; Mtfr1; RGD1304936
• Common Name: MTFR1
• Gene Symbol: Mtfr1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KPKPVDATDPAALIAEALKKKFAYRYRSDSQDEVEKGIPKSESEATSERVLFGPHMLKPTGKMKALIENVSD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining