Invitrogen™ Human MTF2 (aa 440-520) Control Fragment Recombinant Protein

Product Code. 30213341

Brand: Invitrogen™ RP107670

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67030 (PA5-67030. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Polycomb group (PcG) that specifically binds histone H3 trimethylated at 'Lys-36' (H3K36me3) and recruits the PRC2 complex. Acts by binding to H3K36me3, a mark for transcriptional activation, and recruiting the PRC2 complex, leading to enhance PRC2 H3K27me3 methylation activity. Regulates the transcriptional networks during embryonic stem cell self-renewal and differentiation. Promotes recruitment of the PRC2 complex to the inactive X chromosome in differentiating XX ES cells and PRC2 recruitment to target genes in undifferentiated ES cells. Required to repress Hox genes by enhancing H3K27me3 methylation of the PRC2 complex. In some conditions may act as an inhibitor of PRC2 activity: able to activate the CDKN2A gene and promote cellular senescence by suppressing the catalytic activity of the PRC2 complex locally. Binds to the metal-regulating-element (MRE) of MT1A gene promoter

Specifications

• Accession Number: Q9Y483
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 22823
• Name: Human MTF2 (aa 440-520) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9230112N11Rik; AA537621; C76717; dJ976O13.2; hPCl2; M96; Metal regulatory transcription factor 2; metal response element binding transcription factor 2; metal response element DNA-binding protein M96; metal response element-binding transcription factor 2; metal-response element DNA-binding protein M96; Metal-response element-binding transcription factor 2; mPCl2; MTF2; PCL2; polycomb-like 2; polycomb-like protein 2; putative DNA binding protein; RGD1304727; RP5-976O13.1; TDRD19A; tudor domain containing 19 A; zinc-regulated factor 1; ZiRF1
• Common Name: MTF2
• Gene Symbol: Mtf2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GRTEGTAHSSNTSDVDFTGASSAKETTSSSISRHYGLSDSRKRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEIVKDDE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining