missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MST3 (aa 374-438) Control Fragment Recombinant Protein

Product Code. 30196736
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196736

Brand: Invitrogen™ RP95236

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82917 (PA5-82917. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

STK24 (MST3) is a serine/threonine kinase that is a member of the GCK subfamily of STE20-like proteins. The yeast 'Sterile 20' gene (STE20) functions upstream of the mitogen-activated protein kinase (MAPK) cascade. In mammals, protein kinases related to STE20 can be divided into 2 subfamilies based on their structure and regulation. Members of the PAK subfamily (see PAK3; MIM 300142) contain a C-terminal catalytic domain and an N-terminal regulatory domain that has a CDC42 (MIM 116952)-binding domain. In contrast, members of the GCK subfamily (see MAP4K2; MIM 603166), also called the Sps1 subfamily, have an N-terminal catalytic domain and a C-terminal regulatory domain without a CDC42-binding domain. STK24 belongs to the GCK subfamily of STE20-like kinases.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y6E0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8428
Name Human MST3 (aa 374-438) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1810013H02Rik; C76483; epididymis secretory protein Li 95; HEL-S-95; Mammalian STE20-like protein kinase 3; Mammalian STE20-like protein kinase 3 C-terminal; Mammalian STE20-like protein kinase 3 N-terminal; mammalian sterile twenty 3 kinase; Mst3; MST-3; MST3/C; MST3/N; MST3B; OTTHUMP00000018594; RGD1561742; RP11-111L24.5; serine/threonine kinase 24; serine/threonine kinase 24 (STE20 homolog, yeast); serine/threonine-protein kinase 24; Serine/threonine-protein kinase 24 12 kDa subunit; Serine/threonine-protein kinase 24 35 kDa subunit; Serine/threonine-protein kinase 24 36 kDa subunit; STE20; STE20-like kinase 3; STE20-like kinase MST3; sterile 20-like kinase 3; STK24; STK3
Common Name MST3
Gene Symbol STK24
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.