Invitrogen™ Human MST3 (aa 300-373) Control Fragment Recombinant Protein

Product Code. 30197524

Brand: Invitrogen™ RP95235

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82922 (PA5-82922. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

STK24 (MST3) is a serine/threonine kinase that is a member of the GCK subfamily of STE20-like proteins. The yeast 'Sterile 20' gene (STE20) functions upstream of the mitogen-activated protein kinase (MAPK) cascade. In mammals, protein kinases related to STE20 can be divided into 2 subfamilies based on their structure and regulation. Members of the PAK subfamily (see PAK3; MIM 300142) contain a C-terminal catalytic domain and an N-terminal regulatory domain that has a CDC42 (MIM 116952)-binding domain. In contrast, members of the GCK subfamily (see MAP4K2; MIM 603166), also called the Sps1 subfamily, have an N-terminal catalytic domain and a C-terminal regulatory domain without a CDC42-binding domain. STK24 belongs to the GCK subfamily of STE20-like kinases.

Specifications

• Accession Number: Q9Y6E0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8428
• Name: Human MST3 (aa 300-373) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810013H02Rik; C76483; epididymis secretory protein Li 95; HEL-S-95; Mammalian STE20-like protein kinase 3; Mammalian STE20-like protein kinase 3 C-terminal; Mammalian STE20-like protein kinase 3 N-terminal; mammalian sterile twenty 3 kinase; Mst3; MST-3; MST3/C; MST3/N; MST3B; OTTHUMP00000018594; RGD1561742; RP11-111L24.5; serine/threonine kinase 24; serine/threonine kinase 24 (STE20 homolog, yeast); serine/threonine-protein kinase 24; Serine/threonine-protein kinase 24 12 kDa subunit; Serine/threonine-protein kinase 24 35 kDa subunit; Serine/threonine-protein kinase 24 36 kDa subunit; STE20; STE20-like kinase 3; STE20-like kinase MST3; sterile 20-like kinase 3; STK24; STK3
• Common Name: MST3
• Gene Symbol: STK24
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining