Invitrogen™ Human MSK2 (aa 292-425) Control Fragment Recombinant Protein

Product Code. 30204330

Brand: Invitrogen™ RP91470

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82821 (PA5-82821. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RPS6KA4 (MSK2) is a serine/threonine protein kinase that is essential for the regulation of various cellular processes. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates various substrates, including CREB1 and c-fos. RPS6KA4 contains 2 non-identical kinase catalytic domains and phosphorylates various substrates, including CREB1 and c-fos. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.

Specifications

• Accession Number: O75676
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8986
• Name: Human MSK2 (aa 292-425) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110069D02Rik; 90 kDa ribosomal protein S6 kinase 4; 90 kDa; AI848992; Ccdc88b; coiled-coil domain containing 88 B; EC 2.7.11.1; kinase MSK2; KS6A4; mitogen- and stress-activated protein kinase 2; mitogen- and stress-activated protein kinase-2; mMSK2; MSK2; Nuclear mitogen- and stress-activated protein kinase 2; ribosomal protein kinase B; ribosomal protein S6 kinase A4; ribosomal protein S6 kinase alpha 4; ribosomal protein S6 kinase alpha-4; ribosomal protein S6 kinase, 90 kD, polypeptide 4; ribosomal protein S6 kinase, 90 kDa, polypeptide 4; ribosomal protein S6 kinase, polypeptide 4; RLSK; RPS6KA4; RSKB; RSK-B; RSK-like protein kinase; S6K-alpha-4
• Common Name: MSK2
• Gene Symbol: Rps6ka4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AQEVRNHPFFQGLDWVALAARKIPAPFRPQIRSELDVGNFAEEFTRLEPVYSPPGSPPPGDPRIFQGYSFVAPSILFDHNNAVMTDGLEAPGAGDRPGRAAVARSAMMQDSPFFQQYELDLREPALGQGSFSVC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining