missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201393

Invitrogen™ Human MSI1 (aa 217-274) Control Fragment Recombinant Protein

Product Code. 30201393
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201393

Brand: Invitrogen™ RP107335

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Musashi-1 belongs to the Musashi family of RNA-binding proteins which play a role in cell fate determination, and maintenance of stem-cell state. Musashi family proteins are also involved in post transcriptional gene regulation. The gene encodes a protein with two conserved tandem RNA recognition motifs with highly conserved RNP (ribonucleoprotein) motifs. In mammals, Musashi-1 is expressed in fetal kidney, brain, liver and lung, and in adult brain and pancreas. In humans, the gene is located on chromosome 12.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O43347
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4440
Name Human MSI1 (aa 217-274) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias fb40b12; hypothetical protein LOC541389; m-Msi-1; ms1; msi1; msi1b; Msi1h; Musahi1; musashi homolog 1; Musashi homolog 1(Drosophila); musashi RNA binding protein 1; musashi RNA binding protein 1 b; musashi RNA-binding protein 1; musashi1; musashi-1; RNA-binding protein Musashi homolog 1; RNA-binding protein Musashi homolog 1 L+35 bp; RNA-binding protein Musashi homolog 1 Long; RNA-binding protein Musashi homolog 1 b; wu:fb40b12; zgc:103751; zMsi1
Common Name MSI1
Gene Symbol MSI1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.