Invitrogen™ Human MSANTD3 (aa 215-275) Control Fragment Recombinant Protein

Product Code. 30208036

Brand: Invitrogen™ RP107182

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66513 (PA5-66513. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MSANTD3 is a protein coding gene. Gene Ontology (GO) annotations related to this gene include identical protein binding.

Specifications

• Accession Number: Q96H12
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 91283
• Name: Human MSANTD3 (aa 215-275) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410046L14Rik; 2810429P03Rik; 5730528L13Rik; C8H9orf30; C9orf30; L8; MSANTD3; Myb/SANT DNA binding domain containing 3; Myb/SANT-like DNA-binding domain containing 3; myb/SANT-like DNA-binding domain-containing protein 3; Mysantd3; RGD1308165; UPF0439 protein C9orf30; UPF0439 protein C9orf30 homolog
• Common Name: MSANTD3
• Gene Symbol: MSANTD3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MNEVHVAKIQQIERECEMAEEEHRIKMEVLNKKKMYWERKLQTFTKEWPVSSFNRPFPNSP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining