Invitrogen™ Human MS4A7 (aa 101-184) Control Fragment Recombinant Protein

Product Code. 30202334

Brand: Invitrogen™ RP90412

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (49%), Rat (49%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53603 (PA5-53603. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the membrane-spanning 4A gene family, members of which are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns in hematopoietic cells and nonlymphoid tissues. This family member is associated with mature cellular function in the monocytic lineage, and it may be a component of a receptor complex involved in signal transduction. This gene is localized to 11q12, in a cluster of other family members. At least four alternatively spliced transcript variants encoding two distinct isoforms have been observed.

Specifications

• Accession Number: Q9GZW8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 58475
• Name: Human MS4A7 (aa 101-184) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4 SPAN2; CD20 antigen-like 4; CD20/Fc-epsilon-RI-beta family member 4; CD20L4; CFFM4; Four-span transmembrane protein 2; high affinity immunoglobulin epsilon receptor beta subunit; membrane spanning 4-domains A7; membrane-spanning 4-domains subfamily A member 7; membrane-spanning 4-domains subfamily A member 7; LOW QUALITY PROTEIN: membrane-spanning 4-domains subfamily A member 7; membrane-spanning 4-domains, subfamily A, member 7; MGC22368; MS4A7; MS4A8
• Common Name: MS4A7
• Gene Symbol: MS4A7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining