Invitrogen™ Human MS4A6A Control Fragment Recombinant Protein

Product Code. 30203467

Brand: Invitrogen™ RP90091

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (24%), Rat (24%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52826 (PA5-52826. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May be involved in signal transduction as a component of a multimeric receptor complex.

Specifications

• Accession Number: Q9H2W1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64231
• Name: Human MS4A6A Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4 SPAN3; 4 SPAN3.2; CD20 antigen-like 3; CD20L3; CD20-like precusor; CDA01; four-span transmembrane protein 3; four-span transmembrane protein 3.1; four-span transmembrane protein 3.2; HAIRB-iso; membrane spanning 4-domains A6A; membrane-spanning 4-domains subfamily A member 6 A; membrane-spanning 4-domains subfamily A member 6 D; membrane-spanning 4-domains, subfamily A, member 11; membrane-spanning 4-domains, subfamily A, member 6 A; membrane-spanning 4-domains, subfamily A, member 6 A, isoform 2; Ms4a11; MS4A6; MS4A6A; MS4A6A-polymorph; MST090; MSTP090
• Common Name: MS4A6A
• Gene Symbol: MS4A6A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SFSPNFTQVTSTLLNSAYPFIGPFFVSRVSEEGRMGQRGEEDTNSLDFPPASLLCLICQEQGVNGESCSPV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining