Invitrogen™ Human MRPS5 (aa 356-426) Control Fragment Recombinant Protein

Product Code. 30204964

Brand: Invitrogen™ RP101798

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63173 (PA5-63173. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mitochondrial ribosomes consist of a large 39S subunit and a small 28S subunit, both of which are comprised of multiple mitochondrial ribosomal proteins (MRPs) that are encoded by nuclear genes and are essential for protein synthesis within mitochondria. MRP-S5 (mitochondrial ribosomal protein S5), alternatively known as S5mt, is a 430 amino acid mitochondrial protein belonging to the ribosomal protein S5P family. A component of the 28S subunit, MRP-S5 contains one S5 DRBM domain and exists as two alternatively spliced isoforms. The gene encoding MRP-S5 maps to human chromosome 2, which consists of 237 million bases, encodes over 1,400 genes and makes up approximately 8% of the human genome. A number of genetic diseases are linked to genes on chromosome 2 including Harlequin icthyosis, sitosterolemia and Alstrom syndrome.

Specifications

• Accession Number: P82675
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64969
• Name: Human MRPS5 (aa 356-426) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1620401I16Rik; 28 S ribosomal protein S5, mitochondrial; AI850294; mitochondrial 28 S ribosomal protein S5; mitochondrial ribosomal protein S5; Mitochondrial small ribosomal subunit protein uS5m; MRPS5; MRP-S5; S5mt
• Common Name: MRPS5
• Gene Symbol: MRPS5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QETHQQLADKKGLHVVEIREECGPLPIVVASPRGPLRKDPEPEDEVPDVKLDWEDVKTAQGMKRSVWSNLK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining