Invitrogen™ Human MRPS30 (aa 130-221) Control Fragment Recombinant Protein

Product Code. 30204089

Brand: Invitrogen™ RP92027

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53844 (PA5-53844. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mitochondrial ribosomes consist of a large 39S subunit and a small 28S subunit, both of which are comprised of multiple mitochondrial ribosomal proteins (MRPs) that are encoded by nuclear genes and are essential for protein synthesis within mitochondria. MRP-S30 (mitochondrial ribosomal protein S30), also known as PDCD9 (programmed cell death protein 9), is a 439 amino acid protein that localizes to the mitochondrion, where it exists as a component of the 28S ribosomal subunit and works in conjunction with other MRPs to mediate protein synthesis. MRP-S30 is expressed in kidney, liver, heart and skeletal muscle. The gene encoding MRP-S30 maps to human chromosome 5, which contains 181 million base pairs and comprises nearly 6% of the human genome. Deletion of the p arm of chromosome 5 leads to Cri du chat syndrome, while deletion of the q arm or of chromosome 5 altogether is common in therapy-related acute myelogenous leukemias and myelodysplastic syndrome.

Specifications

• Accession Number: Q9NP92
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10884
• Name: Human MRPS30 (aa 130-221) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610020A16Rik; 28 S ribosomal protein S30, mitochondrial; 39 S ribosomal protein S30, mitochondrial; AA968347; BM-047; Mitochondrial large ribosomal subunit protein mL65; Mitochondrial large ribosomal subunit protein mS30; mitochondrial ribosomal protein S30; MRP S30; Mrps30; MRP-S30; PAP; PDCD9; programmed cell death 9; Programmed cell death protein 9; S30mt
• Common Name: MRPS30
• Gene Symbol: Mrps30
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EPEPEPALDLAALRAVACDCLLQEHFYLRRRRRVHRYEESEVISLPFLDQLVSTLVGLLSPHNPALAAAALDYRCPVHFYWVRGEEIIPRGH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining