Invitrogen™ Human MRPS18B (aa 161-239) Control Fragment Recombinant Protein

Catalog No. 30209936

Marke: Invitrogen™ RP100644

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60384 (PA5-60384. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S18P family. The encoded protein is one of three that has significant sequence similarity to bacterial S18 proteins. The primary sequences of the three human mitochondrial S18 proteins are no more closely related to each other than they are to the prokaryotic S18 proteins. Pseudogenes corresponding to this gene are found on chromosomes 1q and 2q.

Spezifikation

• Accession Number: Q9Y676
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 28973
• Name: Human MRPS18B (aa 161-239) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2400002C15Rik; 28 S ribosomal protein S18-2, mitochondrial; 28 S ribosomal protein S18b, mitochondrial; C6orf14; HSPC183; HumanS18a; mitochondrial ribosomal protein S18-2; mitochondrial ribosomal protein S18B; Mitochondrial small ribosomal subunit protein bS18b; Mitochondrial small ribosomal subunit protein mS40; MRP-S18-2; MRPS18-2; MRPS18B; MRP-S18-b; mrps18-b; PTD017; S18amt; S18mt-b
• Common Name: MRPS18B
• Gene Symbol: MRPS18B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining