missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MRPL51 (aa 64-123) Control Fragment Recombinant Protein

Product Code. 30182252
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30182252

Brand: Invitrogen™ RP97689

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58988 (PA5-58988. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mammalian mitochondrial ribosomes (mitoribosomes) are responsible for protein synthesis within the mitochondrion. The mitoribosomes are composed of a 4:1 ratio of protein to RNA, with the proteins forming two subunits, the 28S subunit and the 39S subunit. Across species, the proteins that make up the mitoribosome subunits vary greatly in sequence, preventing easy recognition by sequence homology. MRP-L51(mitochondrial ribosomal protein L51), also known as CDA09, MRP64, bMRP64 or HSPC241, is a 128 amino acid mitochondrial ribosomal protein. MRP-L51 is a component of the mitochondrial ribosome large subunit (39S) which consists of a 16S rRNA and about 50 distinct proteins.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q4U2R6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51258
Name Human MRPL51 (aa 64-123) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610511M02Rik; 39 S ribosomal protein L51, mitochondrial; bMRP64; bMRP-64; CDA09; HSPC241; L51mt; Mitochondrial large ribosomal subunit protein mL51; mitochondrial ribosomal protein 64; mitochondrial ribosomal protein bMRP64; mitochondrial ribosomal protein L51; MRP64; MRPL51; MRP-L51; rm51
Common Name MRPL51
Gene Symbol MRPL51
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.