Invitrogen™ Human MRPL51 (aa 64-123) Control Fragment Recombinant Protein

Product Code. 30182252

Brand: Invitrogen™ RP97689

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58988 (PA5-58988. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mammalian mitochondrial ribosomes (mitoribosomes) are responsible for protein synthesis within the mitochondrion. The mitoribosomes are composed of a 4:1 ratio of protein to RNA, with the proteins forming two subunits, the 28S subunit and the 39S subunit. Across species, the proteins that make up the mitoribosome subunits vary greatly in sequence, preventing easy recognition by sequence homology. MRP-L51(mitochondrial ribosomal protein L51), also known as CDA09, MRP64, bMRP64 or HSPC241, is a 128 amino acid mitochondrial ribosomal protein. MRP-L51 is a component of the mitochondrial ribosome large subunit (39S) which consists of a 16S rRNA and about 50 distinct proteins.

Specifications

• Accession Number: Q4U2R6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51258
• Name: Human MRPL51 (aa 64-123) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610511M02Rik; 39 S ribosomal protein L51, mitochondrial; bMRP64; bMRP-64; CDA09; HSPC241; L51mt; Mitochondrial large ribosomal subunit protein mL51; mitochondrial ribosomal protein 64; mitochondrial ribosomal protein bMRP64; mitochondrial ribosomal protein L51; MRP64; MRPL51; MRP-L51; rm51
• Common Name: MRPL51
• Gene Symbol: MRPL51
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining