Invitrogen™ Human MRPL37 (aa 123-196) Control Fragment Recombinant Protein

Product Code. 30201573

Brand: Invitrogen™ RP94068

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55274 (PA5-55274. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit.

Specifications

• Accession Number: Q9BZE1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51253
• Name: Human MRPL37 (aa 123-196) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2300004O14Rik; 39 S ribosomal protein L2, mitochondrial; 39 S ribosomal protein L37, mitochondrial; AI132596; HSPC235; L2mt; L37mt; MGC878; Mitochondrial large ribosomal subunit protein mL37; mitochondrial ribosomal protein L37; MRPL2; MRP-L2; MRPL37; MRP-L37; ribosomal protein, mitochondrial, L2; RPML2
• Common Name: MRPL37
• Gene Symbol: MRPL37
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LTKTKLIEGLPEKVLSLVDDPRNHIENQDECVLNVISHARLWQTTEEIPKRETYCPVIVDNLIQLCKSQILKHP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining