Invitrogen™ Human MRP3 (aa 814-944) Control Fragment Recombinant Protein

Product Code. 30211414

Brand: Invitrogen™ RP103027

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83912 (PA5-83912. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. The specific function of this protein has not yet been determined; however, this protein may play a role in the transport of biliary and intestinal excretion of organic anions. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.

Specifications

• Accession Number: O15438
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8714
• Name: Human MRP3 (aa 814-944) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ABC31; ABCC3; ATP binding cassette subfamily C member 3; ATP-binding cassette sub-family C member 3; ATP-binding cassette, subfamily C (CFTR/MRP), member 3; ATP-binding cassette, sub-family C (CFTR/MRP), member 3; canalicular multispecific organic anion transporter 2; canicular multispecific organic anion transporter; cMOAT2; DKFZp686E22157; EST90757; MLP2; MLP-2; MOAT-D; Mrp3; MRP-like protein 2; multidrug resistance associated protein; multidrug resistance protein 3; multidrug resistance-associated protein 3; multi-specific organic anion transporter D; organic anion transporter
• Common Name: MRP3
• Gene Symbol: ABCC3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FLPQTDFIIVLADGQVSEMGPYPALLQRNGSFANFLCNYAPDEDQGHLEDSWTALEGAEDKEALLIEDTLSNHTDLTDNDPVTYVVQKQFMRQLSALSSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining