Invitrogen™ Human MRP2 (aa 187-272) Control Fragment Recombinant Protein

Product Code. 30212084

Brand: Invitrogen™ RP109248

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (58%), Rat (58%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain. This gene product interacts with various cytoskeletal proteins and cell junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, and apico-basal polarity and tumor suppression pathways in non-erythroid cells. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q92887
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1244
• Name: Human MRP2 (aa 187-272) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ABC30; Abcc2; AI173996; ATP binding cassette subfamily C member 2; ATP-binding cassette sub-family C member 2; ATP-binding cassette, subfamily C (CFTR/MRP), member 2; ATP-binding cassette, sub-family C (CFTR/MRP), member 2; calicular multispecific organic anion transporter; canalicular multidrug resistance protein; Canalicular multispecific organic anion transporter 1; Cmoat; CMOAT1; Cmrp; DJS; Human MRP2; KIAA1010; MRP2; multidrug resistance associated protein 2; multidrug resistance protein 2; multidrug resistance-associated protein 2
• Common Name: MRP2
• Gene Symbol: ABCC2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NNESSNNPSSIASFLSSITYSWYDSIILKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEKSSQQNSGAR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining