Invitrogen™ Human MRP1 (aa 226-317) Control Fragment Recombinant Protein

Product Code. 30203125

Brand: Invitrogen™ RP109526

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutathione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternative splicing by exon deletion results in several splice variants but maintains the original open reading frame in all forms.

Specifications

• Accession Number: P33527
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4363
• Name: Human MRP1 (aa 226-317) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ABC29; ABCC; Abcc1; Abcc1a; Abcc1b; ATP binding cassette subfamily C member 1; ATP-binding cassette sub-family C (CFTR/MRP) member 1 A; ATP-binding cassette sub-family C member 1; ATP-binding cassette transporter variant ABCC1delta-e x 13; ATP-binding cassette transporter variant ABCC1delta-e x 13&14; ATP-binding cassette transporter variant ABCC1delta-e x 25; ATP-binding cassette transporter variant ABCC1delta-e x 25&26; ATP-binding cassette, subfamily C (CFTR/MRP), member 1; ATP-binding cassette, sub-family C (CFTR/MRP), member 1; ATP-binding cassette, sub-family C (CFTR/MRP), member 1 A; ATP-binding cassette, sub-family C (CFTR/MRP), member 1 b; Avcc1a; DKFZp686N04233; DKFZp781G125; Glutathione-S-conjugate-translocating ATPase ABCC1; GS-X; leuk; leukotriene C(4) transporter; LTC4 transporter; Mdrap; MRP; Mrp1; multidrug resistance protein 1; multidrug resistance-associated protein 1; multiple drug resistance-associated protein
• Common Name: MRP1
• Gene Symbol: ABCC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining